PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.GQN6H
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family MYB_related
Protein Properties Length: 238aa    MW: 25730.7 Da    PI: 9.5528
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.GQN6HgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding461.2e-1493137347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE+ +++ + ++lG+g+W+ I+r + ++Rt+ q+ s+ qky
      Aradu.GQN6H  93 AWTEEEHRRFLVGLEKLGKGDWRGISRNFVTTRTPTQVASHAQKY 137
                      7*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.60.101.7E-4320IPR001878Zinc finger, CCHC-type
PROSITE profilePS501588.565320IPR001878Zinc finger, CCHC-type
PROSITE profilePS5129418.11986142IPR017930Myb domain
SuperFamilySSF466895.23E-1888143IPR009057Homeodomain-like
TIGRFAMsTIGR015571.7E-1889140IPR006447Myb domain, plants
SMARTSM007171.6E-1090140IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.5E-1191136IPR009057Homeodomain-like
PfamPF002495.5E-1293137IPR001005SANT/Myb domain
CDDcd001671.55E-993138No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 238 aa     Download sequence    Send to blast
MGRKCSHCGN VGHNSRTCTS SSFLGIRLFG THLLADPSSS SSSPATMMTM NNKYFSMDSL  60
TLFPTTTTTT TTTAAIGYLS DGAPPQDKKK GVAWTEEEHR RFLVGLEKLG KGDWRGISRN  120
FVTTRTPTQV ASHAQKYFLR LANTVNHNKR RSSLFDTNNT PPTTAAAAAA TLSFHFLEQQ  180
QTINNSNKPL LSTETTSESS SSSSSSSSMY NNSVPPPDLD LTLAPPPPPN SSSCFPQL
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00565DAPTransfer from AT5G56840Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF2086710.0KF208671.1 Arachis hypogaea putative MYB-related protein 17 (MYB17) gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015955235.11e-175PREDICTED: transcription factor DIVARICATA-like
TrEMBLV5T7091e-111V5T709_ARAHY; Putative MYB-related protein 17
STRINGGLYMA08G03330.13e-59(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF32133271
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56840.14e-55MYB_related family protein